SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000688 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000688
Domain Number 1 Region: 97-263
Classification Level Classification E-value
Superfamily RUN domain-like 3.53e-51
Family RUN domain 0.000000236
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000688
Domain Number - Region: 288-351
Classification Level Classification E-value
Superfamily Prefoldin 0.00288
Family Prefoldin 0.009
Further Details:      
 
Domain Number - Region: 626-649
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0054
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000688   Gene: ENSMPUG00000000690   Transcript: ENSMPUT00000000700
Sequence length 656
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896966.1:1184370:1262837:-1 gene:ENSMPUG00000000690 transcript:ENSMPUT00000000700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGEDGCPAGREPGPEPGEEFEIVDRSQLPSPGELRSAAKPRTGSEGWSAPILTLARKA
TGNLSASCGSALRAAAGLGGADSGTDGAARAASRCQMMEERANLMHMMKLSVKVLLQSAL
SLGRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKLCPEASDIAT
SVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEFYEPEALMMEEEGMVI
VGLLVGLNVLDANLCLKGEDLDSQVGVIDFSLYLKDVQELDGGKEHERITDVLDQKNYVE
ELNRHLSCTVGDLQSKIDGLEKTNSKLQEELSAATDRICSLQEEQQQLREQNELIRERSE
KSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLELEKELELQIGMKTEME
IAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKVQSAESCLQQKDEAITSFEEKNN
QVMSSMKQMEERLQLSERARRGAEERSHKLQQELGGQTCMLQQQLSQLHEQCSSLEKELK
SEKEQRQALQRELQQEKDTSSLLRAELQQVEGLKKELRDLQDEKVELQKVCEEQEQALQE
MGLHLSQSKLKMEDIKEVNKALKGHTWLKDDEATHCKQCEKEFSISRRKAFSQHRY
Download sequence
Identical sequences M3XNN8
ENSMPUP00000000688 XP_004759073.1.14098 ENSMPUP00000000688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]