SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000720 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000720
Domain Number 1 Region: 768-944
Classification Level Classification E-value
Superfamily Chaperone J-domain 8.11e-48
Family Chaperone J-domain 0.0000000132
Further Details:      
 
Domain Number 2 Region: 94-250
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.04e-27
Family Dual specificity phosphatase-like 0.00029
Further Details:      
 
Domain Number 3 Region: 258-395
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.25e-25
Family PLC-like (P variant) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000720   Gene: ENSMPUG00000000723   Transcript: ENSMPUT00000000734
Sequence length 944
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896990.1:1100849:1241385:1 gene:ENSMPUG00000000723 transcript:ENSMPUT00000000734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATEKGGKKSRRLFSSLRPWKATRRLWRTRSAPKAAQGASSPDMEPSYGGGLFDMVKGG
AGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGDLDFTYVTSRIIVMSFPLDNVDIGFRN
QVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHSRVSECSWPIRQAPSLHNLFAVCRNMY
NWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCNLYSTPGPAVRLLYAKRPGIGLSPSHR
RYLGYMCDLLADKPYRPHFKPLTIKSITVSPVPFFNKQRNGCRPYCDVLIGETKIYTTCA
DFERMKEYRVQDGKIFIPLSITVQGDVVVSMYHLRSTIGSRLQAKVTNTQIFQLQFHTGF
IPLETTVLKFTKPELDACDVPEKYPQLFQVILDVELQPHDKVIDLTPPWEHYCTKDVNPS
ILFSSHQEHQDTLVLGGQAPIDIPPDNPRHFGQGGFFSSLCWQDQKSEKSFCEEDHAALV
NPESEQSDDELLTLSSPHGNASGDKHHGAKKPSKKQQEPAAPPPPEDVDLLGLEGSAVSQ
NFSPPVVPPTNSELLSDLFGGGGAAGPVQAGQSGVEDVFHPSGPASTQSTPRRSAASTSA
SPTLRVGEGATFDPFGGPSKPSGQDLLGSFLTTSSTSSDPFLQPTRSPSPTVHASSTPAV
NIQPDVSGGWDWHTKPGSFGVGSKSAATSPTGSSHGTPTHQNKPQTLDPFADLGTLGSSS
FASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQQGGSYSWQQTQSKPQTSIPHSSPQHR
PNYNVSFSAMPGGQSERGKGSANLEGKQKAADFEDLLSGQGFNAHKDKKGPRTIAEMRKE
EMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVY
RRAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY
Download sequence
Identical sequences M3XNS0
ENSMPUP00000000720 XP_004763003.1.14098 ENSMPUP00000000720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]