SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000724 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000724
Domain Number 1 Region: 14-268
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.6e-45
Family FCH domain 0.0039
Further Details:      
 
Domain Number 2 Region: 438-496
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-23
Family SH3-domain 0.00064
Further Details:      
 
Domain Number 3 Region: 290-366
Classification Level Classification E-value
Superfamily HR1 repeat 0.0000379
Family HR1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000724   Gene: ENSMPUG00000000727   Transcript: ENSMPUT00000000738
Sequence length 496
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:21702008:21761848:1 gene:ENSMPUG00000000727 transcript:ENSMPUT00000000738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDPLTDCSYNKVYKNLKEFSQNGENFCKQVTSILQQRANLEINYAKGLQKLVIKLSKTL
QSTKKNCLVSAWTWVSEGMKSAADLHQKLGKAIELEAIKPTHQVLSIHEKKRKSLDNEVE
KAANLVIGNWNQQIKAKKKLMVSTKKHEALSHLVESSKQTVTKKEKQKLLSKLKKSTEKL
AKEDENYYQKNLAGCATRLKWENTLESCYQSILELEKERIKLLYNNLNQYTQHISVFGQT
LTTCHTQIHCAVSKIDVEKDTQALMEETAVSSTENKSEFLLTDYLEEDLNSAMNKERQES
SLKSKLLRLQKDIEKASRDQEGLERMLKSYSRDAAFSDPESQKITAALMDETNLKLDLLQ
ANAYKLSSVLAELEQRPQPSHPCSNAIFRWKEKQQTHSYVKISRPFLMKRLENVVSRTCP
GGQRIPISSSTASGVAQLGSGLCKALYSFQARQDDELNLEKGDIVTIYRKQEEGWWFGSL
NGKKGHFPAAYVEELP
Download sequence
Identical sequences M3XNS4
XP_004744067.2.14098 ENSMPUP00000000724 ENSMPUP00000000724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]