SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000742 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000742
Domain Number 1 Region: 178-418
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.02e-53
Family Nuclear receptor ligand-binding domain 0.00000000405
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-17
Family Nuclear receptor 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000742   Gene: ENSMPUG00000000745   Transcript: ENSMPUT00000000756
Sequence length 430
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896964.1:8818106:8853120:1 gene:ENSMPUG00000000745 transcript:ENSMPUT00000000756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRD
SLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHEDLSNYIDGHTPEGSKA
DSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELE
HLAQNISKSHLETCQYLREELQQITWQTFLQEEIESYQNKQREVMWQLCAIKITEAIQYV
VEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSL
GKDHTVSFVLIFKGGLDQIERASRIAMSISSRNVIISLDRSWLQEKVKIEKLQQKIQLAL
QHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTS
EFEPAMQIDG
Download sequence
Identical sequences M3XNU2
ENSMPUP00000000742 ENSMPUP00000000742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]