SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000765 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000000765
Domain Number - Region: 12-77
Classification Level Classification E-value
Superfamily TPR-like 0.0616
Family Tetratricopeptide repeat (TPR) 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000765   Gene: ENSMPUG00000000767   Transcript: ENSMPUT00000000779
Sequence length 259
Comment pep:known scaffold:MusPutFur1.0:GL897209.1:1159318:1166799:-1 gene:ENSMPUG00000000767 transcript:ENSMPUT00000000779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAWVRFSAQSQARERLCRAAQYACSLVGHALQKHGASPELQKQIRQLEGHLSLGRKLLR
LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA
QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGIETAGPGSPGTTG
GGLPQLAVKLQLRVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGL
VSSILSILTLICPWLRLKP
Download sequence
Identical sequences G9KG23
ENSMPUP00000000765 ENSMPUP00000000765 XP_004779712.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]