SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000800 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000800
Domain Number 1 Region: 38-193
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.28e-18
Family G proteins 0.0000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000800   Gene: ENSMPUG00000000803   Transcript: ENSMPUT00000000815
Sequence length 237
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896990.1:3529476:3534583:-1 gene:ENSMPUG00000000803 transcript:ENSMPUT00000000815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSCFGYKKWPIRRLRPLPTLIIIPALMPQNKNKDCCVVLGTAGVGKSVSVQRWVRVNF
PDAYLPTIADTDLHVLSSNHGVGALYSTEATGSPRYPGLQRLAVARGPAVFLVYSANKKQ
TVEELKPFYKLIYKVKDNTLHEYPIVLVDSKCQESRWESMVSAACALEWNCAFLETSAEM
DISVQEIFHTLPNQEKMPAACLHHPQKKSLMPETAEKLLNKCTVMSRRCRMPPGQSC
Download sequence
Identical sequences M3XP00
ENSMPUP00000000800 XP_004763044.1.14098 ENSMPUP00000000800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]