SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000808 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000808
Domain Number 1 Region: 77-163
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000189
Family PDZ domain 0.063
Further Details:      
 
Domain Number 2 Region: 4-69
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000089
Family HtrA-like serine proteases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000808   Gene: ENSMPUG00000000812   Transcript: ENSMPUT00000000824
Sequence length 442
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:23537158:23558739:1 gene:ENSMPUG00000000812 transcript:ENSMPUT00000000824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTL
ELRETSVTPSNMWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYII
GADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYG
YLHRIPTRPFEEGKKISLPGQMTGTPITPLKDGFTEVQLSSVNPPSLSPPGTTEIEQGLS
GLSISSTPPAVSNVLSTDRVFVSGVPTVPLLPPQVNQSLTSVPPMNPATTLPGLMPLPTG
LPNLPALPNLNLPTPHVMPGVSLPELVNPGLPPLPSLPPRNLPGIAPLPMPSEFLPSFPL
VPEVSSAASSGELLSSLPPTGSPPSDPVTTTARADAASSPAVDVTPPAPKAPSTVEDRGC
EPTPASEKPVSAVTDASASESP
Download sequence
Identical sequences M3XP08
ENSMPUP00000000808 ENSMPUP00000000808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]