SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000850 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000850
Domain Number 1 Region: 457-653,754-1010
Classification Level Classification E-value
Superfamily Ras GEF 5.23e-115
Family Ras GEF 0.00025
Further Details:      
 
Domain Number 2 Region: 200-338
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-43
Family DEP domain 0.000000157
Further Details:      
 
Domain Number 3 Region: 661-763
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.83e-36
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 4 Region: 21-157
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.59e-26
Family cAMP-binding domain 0.000000194
Further Details:      
 
Domain Number 5 Region: 331-460
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.45e-25
Family cAMP-binding domain 0.000000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000850   Gene: ENSMPUG00000000854   Transcript: ENSMPUT00000000866
Sequence length 1011
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:25111460:25399834:1 gene:ENSMPUG00000000854 transcript:ENSMPUT00000000866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGY
YENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDN
TPRHATIVTRESSELLRIEQKDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENT
PLIEPHVPLRPANTISKVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTE
LVDWMLQQTSCVHSRTQAVGMWQVLVEDNVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLP
TEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEELIHIKALSHL
STTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD
FGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKV
PAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEPALNEATDSVLNDFVMMHCVF
MPNTQLCPALVAHYHAQPSQGTEQEKMDYTLNNKRRVIRLVLQWAAVYGDVLQEDDVAVA
FLEEFYVSVSDDARMIAALKDQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQK
RQPIRGSDEVLFKVYCLDHTYTTIRVPVAASVKEVISAVADKLGSGEGLIIVKMSSGGEK
VVLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTVGTVGTFELMSSKDLAYQM
TIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQPSKR
VQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLM
DPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTART
VRYCRSQAFNPDAAQASKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
Download sequence
Identical sequences M3XP50
XP_004744138.1.14098 ENSMPUP00000000850 ENSMPUP00000000850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]