SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000871 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000871
Domain Number 1 Region: 418-697
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-78
Family Protein kinases, catalytic subunit 0.0000000434
Further Details:      
 
Domain Number 2 Region: 864-1006
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.57e-57
Family FAT domain of focal adhesion kinase 0.00000741
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-42
Family Second domain of FERM 0.0000203
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-33
Family First domain of FERM 0.00039
Further Details:      
 
Domain Number 5 Region: 261-366
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-30
Family Third domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000871   Gene: ENSMPUG00000000875   Transcript: ENSMPUT00000000887
Sequence length 1009
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897105.1:1338989:1464267:1 gene:ENSMPUG00000000875 transcript:ENSMPUT00000000887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIQDVIASILMSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LKEEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQSLSIKTSSLAEAENMADLVDGYCRLQGEHKG
SLIIHPKKDGEKRNSLPQIPMLNLEAQRPHLSESCSIESDIYAEIPDETLRRPGGPQYGV
ARGDVVLNRILGEGFFGEVYEGVYTNHKGEKFNVAVKTCKKDCTLDNKEKFLSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASSECVKLGDFGLSRYIEDEEYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPILYTLMTR
CWDYDPSERPRFTELVCNLSDIYQMEKDIAIEQERNARYRPPKILEPTAYQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAERLKMRQILDKQQKQMVEDYQWLRQEEKSLDPMLYMNDKSP
LTPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences M3XP71
ENSMPUP00000000871 ENSMPUP00000000871 XP_004775156.1.14098 XP_004775157.1.14098 XP_004775158.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]