SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000923 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000923
Domain Number 1 Region: 117-168
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000113
Family SNARE fusion complex 0.0035
Further Details:      
 
Domain Number 2 Region: 360-414
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000131
Family SNARE fusion complex 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000923
Domain Number - Region: 21-81
Classification Level Classification E-value
Superfamily PH domain-like 0.02
Family VPS36 N-terminal domain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000923   Gene: ENSMPUG00000000929   Transcript: ENSMPUT00000000941
Sequence length 415
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897261.1:57181:94455:1 gene:ENSMPUG00000000929 transcript:ENSMPUT00000000941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSREICVHSWPCSYYLEPEKRWVSGKLSLTTHSLRFAADKTGEALVSFPLSSVIEIKKEA
SHFVFSSITVLEKDHVKHWFSSLQPSRNVVFSIIEHFWREVLLSPAEVPLPATKGKQLTG
LMACSQKRLEETARVLHHQGEQLDSITRGLEKMDSDLDVADRLLTELESPSWWPFSSKLW
KMPAESKPKKGTATAGPKALGKEGVVVRIPAVVSQGTGCHVKAGSLTLLVSGLEIHDSSS
LLMHRFEREDIDDIKVHTPYEISIRQRFIGKPDIAYRLISARMPEALPILEVQFSQKMEL
LEGALMPKSARMSSLAEKGCTVWQAASGLMDRAVHREPCLASQEAQLLPPQMSEPLVSEG
DAQELRQILRKLKSLALDTETELERQDEALDGITAAVDRTTLTIDKHTRRAKKLT
Download sequence
Identical sequences M3XPC3
ENSMPUP00000000923 ENSMPUP00000000923 XP_004780653.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]