SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000930 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000930
Domain Number 1 Region: 230-379
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 120-229
Classification Level Classification E-value
Superfamily Second domain of FERM 1.1e-23
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 34-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.07e-21
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000930   Gene: ENSMPUG00000000936   Transcript: ENSMPUT00000000948
Sequence length 1058
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897101.1:1264206:1574477:1 gene:ENSMPUG00000000936 transcript:ENSMPUT00000000948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVQAAVAPNRSQRLLLKIPYGSLRRRSVERMTEGRRCQVHLLDDRKLELLVQPKLLAKE
LLDLVASHFNLKEKEYFGIAFTDETGHLNWLQLDRRVLEHDFPKKSGPVVLYFCVRFYIE
SISYLKDNATIELFFLNAKSCIYKELIDVDSEVVFELASYILQEAKGDFSSNEVVRSDLK
KLPALPTQALKEHPSLAYCEDRVIEHYKKLNGQTRGQAIVNYMSIVESLPTYGVHYYAVK
DKQGIPWWLGLSYKGIFQYDYHDKVKPRKIFQWRQLENLYFREKKFSVEVHDPRRASVTR
RTFGHSGIAVHTWYACPALIKSIWAMAISQHQFYLDRKQSKSKIHAARSLSEIAIDLTET
GTLKTSKLANMGSKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQ
RLEELKKLCLREAELTGKLPVEYPLDPGEEPPIVRRRIGTAFKLDEQKILPKGEEAELER
LEREFAIQSQITEAARRLASDPNVSKKLKKQRKTSYLNALKKLQEIENAINENRIKSGKK
PTQRASLIIADGNIASEDSSLSDALVLEDEDSQVTSTLSPLQSPHKGLPPRPPSHNRPPP
PQSLEGLRQMHYHRNDYDKSPIKPKMWSESSLDEPYEKVKKRSSHGHSSSHKRFPSTGSC
AEAGGGSSSLQNSPIRSLPHWNSQSSMPSTPDLRVRSPHYVHSTRSVDLSPTRLHSLALH
FRHRSSSLESQGKLLGSENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHYYPAQM
NANYSTLAEDSPSKARARQRQRQRAAGALGAANSGSMPNLAARGGGAHGVYLHSQSQPSS
QYRIKEYPLYIEGSATPVVVRSLESDQEGHYSVKAQFKTSNSYTAGGLFRESWRGGDEGD
AGRLTPSRSQILRTPSLGREGAHDKGAGRAAVSDELRQWYQRSTASHKEHSRLSHTSSTS
SDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSAALPQSQRSSTPSSEIGATPPSSPHHIL
TWQTGSYTDSCFLDSSLYPELADVQWYGQEKAKPGTLV
Download sequence
Identical sequences M3XPD0
ENSMPUP00000000930 XP_004774927.1.14098 ENSMPUP00000000930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]