SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000961 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000961
Domain Number 1 Region: 621-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000081
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-40
Family Third domain of FERM 0.00012
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-37
Family Second domain of FERM 0.0000778
Further Details:      
 
Domain Number 4 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.72e-23
Family First domain of FERM 0.00098
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 1.6e-20
Family PDZ domain 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000961   Gene: ENSMPUG00000000967   Transcript: ENSMPUT00000000980
Sequence length 926
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896970.1:2555668:2725717:1 gene:ENSMPUG00000000967 transcript:ENSMPUT00000000980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDATDNPRWLDPNKPIRKQLKRGSPYNLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASFAVQSELGDYNQSENLPGYLSDYSFIPDQ
PQDFEKEIAKLHQQHTGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNIFPWLKIVKISFKCKQFFIQLRKEVHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSAFTQEGTRLRPSSVGHLV
DHVVHTSPSEVFVNHRSPSSTQANSIVLESSPSQETPGDGQPPALPPKQSKKNSWNQIHY
SHSQQDLENHINETFDVPSSPEKSTPNGGIPQDNLVLIRMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELVLL
VRPNAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLQESMIQLAEGLITGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTESSSYGCYQ
VTCHSEEGNTAYIFRKMTLFNQEKNESRQLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPIVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTTSSNK
Download sequence
Identical sequences M3XPG1
XP_004759829.1.14098 ENSMPUP00000000961 ENSMPUP00000000961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]