SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000969 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000969
Domain Number 1 Region: 228-373
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-39
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-36
Family Second domain of FERM 0.0000673
Further Details:      
 
Domain Number 3 Region: 40-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-24
Family First domain of FERM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000969   Gene: ENSMPUG00000000976   Transcript: ENSMPUT00000000989
Sequence length 732
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896970.1:2752898:2885801:1 gene:ENSMPUG00000000976 transcript:ENSMPUT00000000989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQLAAYNLQAELGDYDLAEHS
PELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQTTKTNK
PRRSTSFERRPSKRYSRRTLQMKGSTAKPEELSVHNNVSTQSNGSQQAWDVKSTLPVIPS
VPSGPVLAEIENLPRNPGIDQHDRKCLPLNTDLLDSPELLETTIDDIVGAPDTLEIPQAP
EEVNIVTRQTGLEGTKEECGTLKEDSQKLKHLEVESSPLPTSRPNVDVNINNQEEVVKLT
EKCLNNAIESPGLNARRVPPDLKSNILKAQVEAVHKVTREDSLLGHKNTSVQDASTNSAV
LNENNVPFPEDSLALMHTTPAANGSVLKDATDELDALLLSLTENLMDHTVPPQVSSTSMI
TPRWIVPQSGVLSSGLAGSGPPLAGKEGHGNREVISLISPPAPFLVDAVTSSLPTLAEET
VLKQKCLLTTEL
Download sequence
Identical sequences M3XPG9
XP_004759821.1.14098 XP_004759822.1.14098 ENSMPUP00000000969 ENSMPUP00000000969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]