SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000973 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000973
Domain Number 1 Region: 721-772
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000176
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Domain Number 2 Region: 1049-1096
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000171
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000973
Domain Number - Region: 522-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0365
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000973   Gene: ENSMPUG00000000980   Transcript: ENSMPUT00000000993
Sequence length 1114
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896908.1:4234625:4440363:-1 gene:ENSMPUG00000000980 transcript:ENSMPUT00000000993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYEVNAGYDFTNMVRKKNPPLRNVASEGEGQSLEPIGTESKVSGKNKEFSADQMSENTD
QSDAAELNNKEEHSSHGQDPSSSSKKGLKSSVLSEKAGFNYESPSKGGNLPSHPHDEVTD
RNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSLETKEDHKMSPKATEETGQA
QSGQANCQGSSPVSVASKNPQVPSDGGVRLNKSKTDLLVNDIPDPAPLSPELQDFKCNIC
GYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVL
SGVLQDINSSRPVLLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSS
TELEQHFLQTHPNKIKASLPSSEGAKPSEKNSNKSIPALRSSDSGDLGKWQDKITVKTGD
DTPVGYSVPIKPLDSSRQNAGSSRVKHQCHQCSFSTPDVDVLLFHYESSHESQASEVKQE
ANHLQGSDGQPAVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADTQSL
LEHFNTVHCHEQDITTANGEEDGHAVSTIKEEPKIDLKVYSLLNPDSKMGEPVSESVVKR
EKVEDKDGLKDKVWTESSSDDLRNMTWRGADILRGSPSYTQASLGLLTPVSGPQEQTKTL
RDSPNVEAAHLARPIYGLAVETKGFLQGVPAGGEKSGTLTQQYPASGENKSKDESQSLLR
RRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRR
RTRKRLNPEALQAEQLNKQQRGGSEEQVNGSPLERRSEDHLTEGHQREIPLPSLSKYEAQ
GSLTKSHSAQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSP
IEKYMRPAKHPNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHY
LSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKA
PSNVKSEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSI
CQHLCTDKYDFTTHIQRGLHRNNAQAEKNGKPKE
Download sequence
Identical sequences M3XPH3
XP_012907183.1.14098 ENSMPUP00000000973 ENSMPUP00000000973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]