SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000991 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000991
Domain Number 1 Region: 133-301
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.24e-22
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0079
Further Details:      
 
Domain Number 2 Region: 83-127
Classification Level Classification E-value
Superfamily TGS-like 0.0000193
Family TGS domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000991   Gene: ENSMPUG00000000998   Transcript: ENSMPUT00000001011
Sequence length 335
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896955.1:1760972:1785285:-1 gene:ENSMPUG00000000998 transcript:ENSMPUT00000001011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGIRGLRLWRAAPSGGAGWRSIATSPASRLSPTERAERQNDLFNQEKHRQLSFTPRTE
KIEVKHVGKTDPGTVFVMNKNISTPYNCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSC
EIEFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVSLVRAPEVPVICGAFCYDV
VLDKRLDEWMPTKENLRSFTKDAHTLIYKDLPFEVLEVEAKVALEIFQHNKYKMDFIEEK
ASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSAVHNLQATPLGLVRRFQGLSLP
VHLRAHFTIWNKLLERSRKMVTEDQTKPTEESAST
Download sequence
Identical sequences M3XPJ1
ENSMPUP00000000991 XP_004757494.1.14098 ENSMPUP00000000991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]