SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001004 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001004
Domain Number 1 Region: 288-422
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.07e-33
Family Synaptotagmin-like (S variant) 0.000000469
Further Details:      
 
Domain Number 2 Region: 146-270
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-31
Family Synaptotagmin-like (S variant) 0.0000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001004   Gene: ENSMPUG00000001012   Transcript: ENSMPUT00000001025
Sequence length 425
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896931.1:5639565:5650473:1 gene:ENSMPUG00000001012 transcript:ENSMPUT00000001025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGV
DIYPENLSSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKASSPSDLEN
VTPKLFSEGEKEAVSPDSLKSSTSITSEEKQEKLGTLFFSLEYNFEKKAFVVNIKEARGL
PAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGILYTQIQELALHF
TILSFDRFSRDDIIGEVLIPLAGIELSDGKMLMNREIIKRNVRKSSGRGELLISLCYQST
TNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVF
DIPCEGLEEISVEFLVLDSERGSRNEVIGRLVLGAAAEGTGGEHWKEICDYPRRQIAKWH
MLCDG
Download sequence
Identical sequences M3XPK4 U6CWB5
ENSMPUP00000001004 ENSMPUP00000001004 XP_004752289.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]