SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001010 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001010
Domain Number 1 Region: 538-883
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-87
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000609
Further Details:      
 
Domain Number 2 Region: 266-410,473-520
Classification Level Classification E-value
Superfamily ARM repeat 1.96e-65
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00028
Further Details:      
 
Domain Number 3 Region: 36-166
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.47e-41
Family PLC-like (P variant) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001010   Gene: ENSMPUG00000001018   Transcript: ENSMPUT00000001031
Sequence length 887
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896931.1:6741785:6881672:-1 gene:ENSMPUG00000001018 transcript:ENSMPUT00000001031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFEIVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQGSVSESVSNSGINSAEIDSSQIITSPLPPVSSPPPAAKTKDSSDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
Download sequence
Identical sequences M3XPL0
ENSMPUP00000001010 XP_004752293.1.14098 ENSMPUP00000001010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]