SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001038 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001038
Domain Number 1 Region: 59-122
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000523
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001038   Gene: ENSMPUG00000001046   Transcript: ENSMPUT00000001059
Sequence length 176
Comment pep:novel scaffold:MusPutFur1.0:GL897120.1:1051082:1487097:-1 gene:ENSMPUG00000001046 transcript:ENSMPUT00000001059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAGAAANGTPQNVQGITSYQQRLTAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRK
EKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPP
WNLRMEGPPPNTSVKVIGAQRRRSPSALAIEVFEAHLGSHILQGEETKVQSGEVTC
Download sequence
Identical sequences M3XPN8
ENSMPUP00000001038 ENSMPUP00000001038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]