SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001043 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001043
Domain Number 1 Region: 774-880
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000209
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 2 Region: 1079-1188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000851
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 3 Region: 960-1055
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000331
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001043   Gene: ENSMPUG00000001051   Transcript: ENSMPUT00000001064
Sequence length 2319
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897120.1:1572428:2020589:-1 gene:ENSMPUG00000001051 transcript:ENSMPUT00000001064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTMSVTLSPLRSQDLDPMATDASPMAINLTPTVEQGEGGEAMKDMDSDQQYEKPPPLHT
GADWKIVLHLPEIETWLRMTSERVRDLTYSVQQDSDSKHVDVHLVQLKDICEDISDHVEQ
IHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQT
DILQAFSEETNEGRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLGGL
GDMTSSQVKTKPFDSWSYSEMEKEFPELIRSVGLLSVATDSNPYSCGKAVGEEASQVSLS
ADDKGGREEDSALTVEEPPGLVPGTSSSGEALTNADQPPPEAVMPEASSSSQPETRNQQP
QPCENATPKRSIRDCFNYNEDSPTQPTLPKRGLFLKEENFKNNLKGTDGKKQLADLKPEM
SRSTPSLVDPPDRSKLCLVLQSSYPSSPSAASQSYECLHKVGEGNLENTVKSHIKEISSS
LGRLSDCHKEKLRLKKPHKAPVEVPPCRTLKQGAGSGNQAESTKSSAMPNGIPSGTPKAV
EGPETDSVLTSSLEPCRQTSWNAKLPVQSETSSSPPFTQSSESSVGSDNVASPVSLLSKT
KSKKSYSSSPSHVTRNGQVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQKPRGE
TIQNIDDWELSEMNSDSEIYPTYHVKKKHTRLGRVSPSSSSDIASSLGESMESGPLSDIL
SDEELCMPLSGMKKYIDEKSERAASSEKKESHSATKSALIQKLMQDIQHQDNYEAIWEKI
EGFVNKLDEFIQWLNEAMETTENWTPPKAETDGLKLYLETHLSFKLNVDSHCALKEAVEE
EGYQLLELIASHKAGLKDMLRMIASQWKELQRQIKRQHSWILRALDTIKAEILATDVSVE
GEEGTGSPKTEVQLCYLEAQRDAVEQMSLKLYSEQYTSSSKRKEEFADMSKVHSVGGNGL
LDFDSEYQELWDWLIDMESLVMDSHDLMMSEEQQQHLYKRYSVEMTIRDLKKTELLSKVE
ALKKGGVLLPNDLLEKVDSINEKWELLGKTLRQKIQDTMAGHSGSGPRDLLSPESGNLVR
QLEVRIKELKGWLRDTELFIFNSCLRQEKEGTMNAEKQLQYFKSLCGEIKQRRRGVASIL
RLCQHLLDDRETCNLNADHQPMQLIIVNLERRWEAIVMQAVQWQTRLQKKMGKESETLNV
IDPGLMDLNGTSEDALEWDETDISNKLISLNEDSSDLDQEPQPVMPSLKLEEIGSEDPGY
EEEAGDHGGSQYASSITAPSSPHIYQVYSLHNVELYEDSHMPFLKNNPKFTSVTQPSVLT
KSLSKDSSFSSTKSLPDLVGGSNLVKPCPCHGGDMSQNSGSESGIVSEGDTETTTNSEMC
LLNVVDGSPSNPETEHLDPQMGDAVNVLKQKFKDEEEHIKLPNSSQSSISPVSCVNGKVG
DLNSVTKYTPDCLGEELQGKHNVFTFYDYSYLQGSKLKLPMIMKQSQSEKAHVEDPLLHG
FYFDKKSCKSKHQATELQPDAPPHERLLASASHEMDRNSYKSGNGEKTFTGMQNGRQLSL
LSHSSSIESLSPGGDLFGLGILKNGSDSLQRSTSLESWLTSYKSNEDLFSCHSSGDISVS
SGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDMTLQSSSQKMSFSGQLSLDIASSIN
EDSPASLTELSSSDELSLCSEDIVLHKNKIPESNASFRKRLTRSVADESDVNVSMIVNVS
CTSACTDDEDDSDLLSSSTLTLTEEELCIKDEDDDSSIATDDEIYEECNLMSGLDYIKNE
LQTWIRPKLSLTKDKRRCNLSDEIKGSKDVSSSEMTNPSDTLNIEALLNSSIKRLSESNG
NGKNLSHAHELGTKGENKKNIFKVNKDPYVADMENGNIESTPEGQKDEQNGISKESESLG
TTGKKNSDSEHCKCKVFMDSSDDANIAGNEFVPQTVRHRPKKCQNRHHFENPSTASTPTE
KSCPELPSEARVTSRQDSDVLKSSSNDAPSVAGKSARCCRALEQNETEENVSVSDNISCC
DCEPDVSHQKDAEDCSVHDFVKEIIDMASTALKSKSQPENEAAAPTSLTQIKEKVLEHSH
RPIQLRKGDFYSYLSLSSHDSDCGEVTSYVEEKSNTPVPLDMTDSGLEDKEEPECFFEAC
VDDDLDGDEPCLPGPPPDEPAISGEASVPQQTAAGSPEFSDTSLLAEEADMVVLSSPPHQ
EVSDVRKEADGLPQATICGESSELTTSRLGSEKESLENTGESGMPEEHNAASAKSGVPEL
SSKAKQPKDKAALHPNSKTLTCEENLLNLHEELHKNMHR
Download sequence
Identical sequences M3XPP3
ENSMPUP00000001043 ENSMPUP00000001043 XP_012902892.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]