SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001054 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001054
Domain Number 1 Region: 1240-1401
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-75
Family Pleckstrin-homology domain (PH domain) 0.0000000425
Further Details:      
 
Domain Number 2 Region: 1036-1243
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-53
Family DBL homology domain (DH-domain) 0.00000000709
Further Details:      
 
Domain Number 3 Region: 459-581
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 838-916
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000277
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001054
Domain Number - Region: 770-809
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0145
Family Ras-binding domain, RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001054   Gene: ENSMPUG00000001062   Transcript: ENSMPUT00000001075
Sequence length 1591
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896955.1:6882033:7083480:-1 gene:ENSMPUG00000001062 transcript:ENSMPUT00000001075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNVEHEFYGEKHASLGRKHTSRSLRLSHKARRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDSEETRLYGDDATYLADGGRRQHPYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSTEEKDCEEARGMEPRASPRQLSSCQRANSLGDLYAQKN
SGVTANGGPRSKFAGYCRNLVSDIPDLANHKMPPAAAEESLPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPP
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
DAVKKSLEGIFDDTVPDGKREKEMVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHHLDYSAHYLRLKFLIENKMQHYVPKPEEDIYELLYKEIEICP
KVTRNIQIEKSDTASDNYGFSLSSVEEDGVRRLYVNSVKETGLASKKGLKAGDEILEISN
RAAGTLNSSVLKDFLAQPSLGLLVRTCPEPEGGVQLLDCPPHRADGPLDTSESPLAFLSS
NPGHGLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDPSPS
PQDATGPQLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDPAFKAFLDAQNPKQQHSATLESYLIKPIQRILKYPLLL
KELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWPNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAISASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGAAVDTDLREQLQAASISQRERGRRALDSHASRMTQLKKQAALS
GINGGLESPGEEVIWVRREDFAPSKKLNTEI
Download sequence
Identical sequences M3XPQ4
XP_004757551.1.14098 XP_004757552.1.14098 XP_012914286.1.14098 ENSMPUP00000001054 ENSMPUP00000001054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]