SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001064 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001064
Domain Number 1 Region: 10-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.18e-117
Family Motor proteins 0.00000000841
Further Details:      
 
Domain Number 2 Region: 1740-1820
Classification Level Classification E-value
Superfamily Cap-Gly domain 8.25e-30
Family Cap-Gly domain 0.00000963
Further Details:      
 
Domain Number 3 Region: 406-500
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.68e-24
Family FHA domain 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001064
Domain Number - Region: 811-934
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0124
Family PLC-like (P variant) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001064   Gene: ENSMPUG00000001073   Transcript: ENSMPUT00000001086
Sequence length 1886
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897105.1:3144528:3286454:-1 gene:ENSMPUG00000001073 transcript:ENSMPUT00000001086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTEATVRSQPKVFAYDHCFWSMDESVREKYAGQDDVFKCLGENILQNAFDGYNACIFAY
GQTGSGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNEKVRDLL
DPKGSRQTLKVREHNVLGPYVDGLSKLAVTSYKDIESLMSEGNKSRTVAATNMNEESSRS
HAVFKITLTHTLYDVKSGTSGEKVGKLSLVDLAGSERATKTGAAGDRLKEGSNINKSLTT
LGLVISALADQSAGKNKNKFVPYRDSVLTWLLKDSLGGNSKTAMVATVSPAADNYDETLS
TLRYADRAKNIVNHAVVNEDPNARIIRDLREEVEKLREQLTKAEAMKSPELKDRLEESEK
LIQEMTVTWEEKLRKTEEIAQERQKQLESLGISLQSSGIKVGDDKCFLVNLNADPALNEL
LVYYLKEHTLIGSANSQDIQLCGMGILPEHCIIDITAEGQVMLTPQKNTRTFVNGSSVSS
PIQLHHGDRILWGNNHFFRLNLPKKKKKADREDEEHDTSMKNDTSSEQLDIDGDSSSEVS
SEINFNYEYAQMEVTMKALGNNVIKTFHSFSLEYKLLHTLFSLIEFLSLHVEHTVDLLFL
CGRQFGMYLTEEREATLNNSLMRLREQIVKANLLVREASYIAEELDKRTEYKVTLQIPAS
SLDANRKRGSLLSEPAIQVRRKGKGKQIWSLEKLDNRLLDMRDLYQEWKECEEDTPVIRS
YFKRADPFYDEQENHSLIGVANVFLESLFYDVKLQYAVPIVNQKGEVAGRLHVEVMRISG
DIGERIAGGDDTSDLSCDKETQENRLVCMVKILQATGLPQHLSHFVFCKYNFWDQQEPVI
VAPEVDTSSSSPVSKEPQCMVVFDHCNEFSVNITEDFIEHLSEGALAIEVYGHKMNDPRK
NPALWDLGIIQAKTRSLRDSWKEVLNKCSLEQWKDIRIALENDASEICSLEDINSKNKDT
MVGISKISVIQGQSRRVQVEVKSVQESGTLPLMEECILSVGIGCVKVRTLRSPKTHETFH
EEEEDMDSYQDRDLERLRRKWLNALTKRQEYLDQQLQKLVSKHDKTEDDADREAQLLEMR
LTLTEERNAVMVPSAGSGIPGAPAEWTPVPGMETHIPVIFLDLNADDFSSQDNLDDPEAG
GWDATLTGEEEDEFFELQIVKQHDGEVRAEASWDSAVHSCPQLSKGTPADERVYLIVRVT
VQLSHPADMQLVLRKRICVHVHGRQGFAQSLLKKMSHRSSIPGCGVTFEIVSNIPEDAQG
VEERETLARMAANVENTASADSEAYIEKYLRSVLAVENLLTLDRLRQEVTVKEQLTGKGK
LSRRSISSPNVNRLSGSRQDLIPFYSLGSNKGRWESQQDVSQTAVSRGIAPVAPSLPNCP
PNNHPPDPGLSSLAASYLNPVKSFVPQMPKLLKSLFPVRDEKRGKQPSPLAHQPVPRIMV
QCALADAGTTGALEREKTNAKLLSLHPPLLQAPSVAPAVTVPLAPVKLHDRPTKAPTPQA
PEVQEGPPSPLSEASSGYFSHSVSSATLSDAFTLGLDGAAAASGQTPGSPPLTLFQATPE
TELPLPPVAPAADSDLPARPLSRSCLLSPVPAKQDAWSDSNASCDTKEPVFSEKEEAGAP
PTPLPTCTPQKESCSRQSGGEVSPATERLGRPEDREKPASGSELDISKPQVPPDLLSLSP
APASPFRIQKVRTSELKSFTRMLGGDPSCSSAAEEDLLASGALGDGGARAPALGKLEVSS
DSEEASEVPEWLKEGEYVTVGTNKMGIVRYIGPTDFQEGTWVGVELDLPSGKNDGSIGGK
QYFKCNPGYGLLVRPGRVRRAAGAGRRRSAGLRLQGAPEPRRSSTLTGSATNLASLTAAL
AKAEGAMALRADRSQKNPENRKSWAS
Download sequence
Identical sequences M3XPR4
ENSMPUP00000001064 ENSMPUP00000001064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]