SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001068 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001068
Domain Number 1 Region: 5-136
Classification Level Classification E-value
Superfamily ENTH/VHS domain 3.92e-28
Family RPR domain (SMART 00582 ) 0.0063
Further Details:      
 
Domain Number 2 Region: 455-581
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.9e-18
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001068   Gene: ENSMPUG00000001078   Transcript: ENSMPUT00000001091
Sequence length 1151
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896955.1:7372843:7417482:-1 gene:ENSMPUG00000001078 transcript:ENSMPUT00000001091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEVLQNLNEELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKV
PGLYVIDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKN
GVFKIEIIQPLLDMAAGTSNAAPVAENVTNNEGSPPPPVKVSSEPPQATTNSVPTVPQLP
SSDAFAAVAQLFQTTQGQQLQQILQTFQQPPKPQSPAIDNAVMAQVQAITAQLKTAPAQP
PEQKAVFPPPEQKTAFDKKLLDRFDYDDEPEAVEESKKEDGATAATAPPAMAVAPPAPSA
TTPAPAPAASPPQAPFGFPGDGMQQPAYTQHQTMDQFQPRMMTMQQDPVHHQKKKVPLPP
NGQMPGFGLLPTPPFPPMAQSVIPPTPPVQQPFQASFQAQSEPLTQKAHQFLKEMEVEQP
CIQEVKRHMSDNRKSRSRSASRSPKRRRSRSGSRSRRSRHRRSRSRSRDRRRHSPRSRSQ
ERRDREKERERRQKGLPQIKPETASVCSTTLWVGQLDKRTTQQDVASLLEEFGPIESINM
IPPRGCAYIVMVHRQDAYRALQKLSRGNYKVNQKSIKIAWALNKGIKADYKQYWDVELGV
TYIPWDKVKPEELESFCEGGMLDSDTLNPDWKGIPKKHENEVAQNGGAETSHTEPVSPIP
KPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPTFTPPLGIPPPGFGPGVPPPP
PPPPFLRPGFNPMHLPPGFLPPGPPPPITPPVSIPPPHTPPISIPNSTIAGINEDTTKDL
SIGNPIPTVVSGARGNAESGDSVKMYGSAVPPAAPTNLPTPPVTQPVSLLGTQGVAPGPV
IGLQAPSTGLLGARPGLIPLQRPPGMPPPHLQRFPLMPPRPMPPHMMHRGPPPGPGGFGM
PPPHGMKGPFPPHGPFVRPGGMPGLGGPGPGPGGPEDRDGRQQQPQPQQPPPPQPQQPPP
AQQQQQQQQPPPQQQQPPPAQQQPQPFRNDNRQQFNSGRDQERFGRRSFGNRVENDRERY
GSRNDDRDNSNRERREWGRRSPDRDRHRDLEERNRRSSGHRDRERDSRDRESRRDKEENR
GKEKPEVTDRAGGNKTAEPPISQVGTVDTVSELGKGESESAVVKPSEELPAEATSSVEPE
KDSGSAAEAPR
Download sequence
Identical sequences M3XPR8
ENSMPUP00000001068 ENSMPUP00000001068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]