SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001087 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001087
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000196
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001087   Gene: ENSMPUG00000001097   Transcript: ENSMPUT00000001110
Sequence length 247
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896931.1:11283535:11527824:1 gene:ENSMPUG00000001097 transcript:ENSMPUT00000001110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSWEQKNNCVLPEDVKNFYLMTNGFHMTWSVKLDEHTIPLGSMAINSISKLTQLNQSS
VYSLPNAPTLADLEDDALEASENQPEKPHFDSRSVIFELDPCNGNGKVCLVYKRGKPALA
QDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFNMYKPV
TYNTDLLAEETNSFVNKLDPSKVFKSKNKTLIPKKKGPVQPAGGQKGPPGPPSTSKSSSS
PGNPVRK
Download sequence
Identical sequences M3XPT7
ENSMPUP00000001087 ENSMPUP00000001087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]