SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001091 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001091
Domain Number 1 Region: 28-161,213-277
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-51
Family Ras GEF 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001091   Gene: ENSMPUG00000001101   Transcript: ENSMPUT00000001114
Sequence length 277
Comment pep:novel scaffold:MusPutFur1.0:GL896940.1:136607:141409:1 gene:ENSMPUG00000001101 transcript:ENSMPUT00000001114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQRRPYGMGFMHWVFLERPWDLSCLGKGTWNEFHPKLVAEQLYYMYTELFKKMVPHQCLG
SVWSRRNRPGNEHVAPTVRATIAQFNVVASCIVTTCLGDPSMTAQDRAVVVGHWIRVAKA
CQILGNYSSLRAILEALQSVSIHCLQRTWDNVSSPEDRPLLTDGVGDGLWATKMMIKGPS
NKLASLVRQLQRAQKGLLKKVSVPEGQGLQGQGVVPYLGTFLSDLVVLDTAMEDYMEGSE
INHHKKNKEYQVLTDIMLLQAAAENYCLDPQHPFTAW
Download sequence
Identical sequences M3XPU1
ENSMPUP00000001091 ENSMPUP00000001091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]