SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001109 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001109
Domain Number 1 Region: 179-292
Classification Level Classification E-value
Superfamily PH domain-like 1.82e-36
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 2 Region: 96-194
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-24
Family PDZ domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001109   Gene: ENSMPUG00000001118   Transcript: ENSMPUT00000001132
Sequence length 329
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896908.1:8771746:8938513:-1 gene:ENSMPUG00000001118 transcript:ENSMPUT00000001132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAAAAAAAGPSGGGGGRAQRSGLLEVLVRDRWHKVLVNLSEDALVLSCEEGAAAYNGI
GTATNGSFCRGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQELGGLGISI
KGGKENKMPILISKIFKGLAADQTQALYVGDAILSVNGADLRDATHDEAVQALKRAGKEV
LLEVKYMREATPYVKKGSPVSEIGWETPPPESPRLGAGASDALSAAQPCSFHRDRKNIPL
KMCFVTRSLASADPENRQLEIHSPDAKHTVILRSKDSATAQAWFSAIHSNVSDLLTQVIA
EVREQLGKTGIAGSREIRHLGWLADKGPW
Download sequence
Identical sequences M3XPV9
ENSMPUP00000001109 ENSMPUP00000001109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]