SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001123 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001123
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.15e-29
Family RPR domain (SMART 00582 ) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001123   Gene: ENSMPUG00000001133   Transcript: ENSMPUT00000001147
Sequence length 312
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896931.1:12157208:12234751:1 gene:ENSMPUG00000001133 transcript:ENSMPUT00000001147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFL
YLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYEND
VLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGD
AAVHQRIASLPVEVQEVSLLDKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQL
TRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRSRIQSLPDLSRLPNVTGSHM
HLPFAGDIYSED
Download sequence
Identical sequences A0A024RC37 A0A1U7T7E0 A0A2I3GA00 A0A2I3TAW6 A0A2J8XFG6 A0A2K5CCX1 A0A2K5QIG1 A0A2K6TL34 D2HQD4 E2RM77 F7GW04 G3QWP7 I3M237 M3WQ72 M3XPX3 Q0P5J9 Q5R8Y3 Q96P16 W5P6D8
ENSOARP00000005992 ENSCJAP00000039168 ENSNLEP00000007565 ENSNLEP00000007565 ENSAMEP00000000867 ENSP00000314602 ENSPPYP00000010232 ENSPPYP00000024540 ENSFCAP00000016502 ENSDNOP00000024977 ENSSTOP00000002986 ENSAMEP00000000867 ENSCAFP00000026368 ENSMPUP00000001123 ENSPPYP00000010232 ENSMPUP00000001123 ENSCAFP00000026368 ENSGGOP00000007212 ENSGGOP00000007212 ENSPVAP00000008654 ENSTTRP00000006700 ENSCJAP00000039174 ENSCJAP00000044700 ENSP00000349955 ENSP00000381984 ENSPVAP00000008654 ENSP00000349955 ENSP00000381984 ENSTTRP00000006700 ENSSTOP00000002986 ENSBTAP00000007226 ENSBTAP00000007226 ENSPTRP00000046467 gi|21361709|ref|NP_060640.2| NP_001126030.1.23681 NP_001229515.1.37143 NP_060640.2.87134 NP_060640.2.92137 XP_002924711.1.58354 XP_003261964.1.23891 XP_003639202.1.84170 XP_003830276.1.60992 XP_003924774.1.74449 XP_004020477.1.66739 XP_004059386.1.27298 XP_004283505.1.21590 XP_004324319.1.83887 XP_004404445.1.74151 XP_004464565.1.11602 XP_004752346.1.14098 XP_004752347.1.14098 XP_005224014.1.76553 XP_005325625.1.77405 XP_006055036.1.26621 XP_006055037.1.26621 XP_006920024.1.64745 XP_006938916.1.62641 XP_007090796.1.5354 XP_007090797.1.5354 XP_007167147.1.59432 XP_007455267.1.90284 XP_008053705.1.4292 XP_008576889.1.73410 XP_008576890.1.73410 XP_008689504.1.72690 XP_008689512.1.72690 XP_008953920.1.60992 XP_008977964.1.60252 XP_009432170.1.37143 XP_010333730.1.74449 XP_010816978.1.76553 XP_010848052.1.44457 XP_010848053.1.44457 XP_011229917.1.58354 XP_011286331.1.62641 XP_011359812.1.92234 XP_011524350.1.92137 XP_012009750.1.54773 XP_012302687.1.9421 XP_012302688.1.9421 XP_012419219.1.74151 XP_014636834.1.5094 XP_014684778.1.49734 XP_014937819.1.86478 XP_014937820.1.86478 XP_015337914.1.40921 XP_015982783.1.101085 XP_017366873.1.71028 XP_017366874.1.71028 XP_017529132.1.32401 XP_017529133.1.32401 XP_017529134.1.32401 XP_018869594.1.27298 XP_019320934.1.44245 XP_019320935.1.44245 XP_019596384.1.88060 XP_019785961.1.83887 XP_019842309.1.53367 XP_019842310.1.53367 XP_020756820.1.74333 XP_020756821.1.74333 ENSPTRP00000046467 9598.ENSPTRP00000046467 9600.ENSPPYP00000010232 9606.ENSP00000349955 9913.ENSBTAP00000007226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]