SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001143 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001143
Domain Number 1 Region: 35-135
Classification Level Classification E-value
Superfamily Cystatin/monellin 4.37e-19
Family Cystatins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001143   Gene: ENSMPUG00000001154   Transcript: ENSMPUT00000001168
Sequence length 137
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896940.1:1670788:1672876:1 gene:ENSMPUG00000001154 transcript:ENSMPUT00000001168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMARLWQVPQILLAILVSLMALTYQEKRKTFLSVKEVPASECYVAATMQYVINDFNEKSD
DKYSFQTVHVLKVQKQITGHVLYHVNMEMRQTTCQKFETTNCSFQEGEIYKQIECFHSVF
VPWFEKYRILNKNCTNG
Download sequence
Identical sequences M3XPZ3
ENSMPUP00000001143 ENSMPUP00000001143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]