SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001167 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001167
Domain Number 1 Region: 351-451
Classification Level Classification E-value
Superfamily PH domain-like 1.3e-34
Family Phosphotyrosine-binding domain (PTB) 0.00000212
Further Details:      
 
Domain Number 2 Region: 203-303
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-27
Family Phosphotyrosine-binding domain (PTB) 0.00000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001167   Gene: ENSMPUG00000001178   Transcript: ENSMPUT00000001192
Sequence length 1428
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897132.1:1352365:1515820:-1 gene:ENSMPUG00000001178 transcript:ENSMPUT00000001192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVGGGGGGGEGGGGGGRTPCNVGTWQLASPCPRIFNLPRESLLPERNSGGKARAPGG
AARGPPAAAARLRQTPARVARDASSPLLGRGGCEETRLLEDPGFTHPRRTASPSGHETPV
NSGRGRLFGAAAASPFGCPSPAPGAAWLSESGVRLSPALFACAGPRRGASAPHPVVFRRL
PLLGCGGGGGSMASPPETDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYEN
EKKWRHKSSAPKRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADNEAEQDSWYQA
LLQLHNRAKGHHDGAAAPGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILK
PKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSA
VTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHL
NNPPPSQVGLTRRSRTESITATSPASMVGGKQGSFRVRASSDGEGTMSRPASVDGSPVSP
STNRTHAHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFP
RRSSASVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMG
GKGSSTLAAPNGHYILPRGGNGHRYIPGTSLGTSPALAGDEAASATDLDNRFRKRTHSAG
TSPTISHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEM
HPLDRRGGHHRPDASTLHTDDGYMPMSPGVAPVPSSRKGSGDYMPMSPKSVSAPQQIINP
IRRHPQRVDPNGYMMMSPSGSCSPDIGGGPSSSTGAAPSGGSYGKLWTNGVGGHHGSALP
HPKLPGESGSSKLLSCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRSFK
HTQRPGELEESARHQHLRLSSSSGRLLYAAAAEDSSSSTSSDSLGGGYCGVRPDPGLPHI
HHQVLQPHLPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRVREQQQQPTLLHPPEPKSP
GEYVNIEFGSDQPGYLSGPVASRSSPSVRCPSQLQPAPREEETGTEEYMNMDLGPGRRAT
WQESTGVQPGRVGPAPPGAASMCRPTRAVPSSRGDYMTMQMGCPGQSYVDTSPVAPISYA
DMRTGVVEEASLPGATAAAPSSSAASASPTTAPQKAGELMARSSLLGAPQGPGAMSAFTR
VNLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRAGNTVPFGGGAAVGGSGGGSSS
TEDMKRHSSASFENVWLRPGELGGAAKEPAPVCGAAGGLENGLNYIDLDLVKDFKQRPQE
RPPQPQPPPPPPPHQPLGSSESSSTSRSSEDLSAYASISFQKQPEDLQ
Download sequence
Identical sequences M3XQ17
ENSMPUP00000001167 ENSMPUP00000001167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]