SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001179 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001179
Domain Number 1 Region: 1218-1349
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-24
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 2 Region: 18-150
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.27e-21
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 
Domain Number 3 Region: 173-285
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.84e-20
Family PLC-like (P variant) 0.074
Further Details:      
 
Domain Number 4 Region: 719-826
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.08e-19
Family Synaptotagmin-like (S variant) 0.014
Further Details:      
 
Domain Number 5 Region: 1443-1608
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-18
Family Synaptotagmin-like (S variant) 0.013
Further Details:      
 
Domain Number 6 Region: 883-989
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000343
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001179
Domain Number - Region: 1691-1732
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.051
Family ABC transporter transmembrane region 0.036
Further Details:      
 
Domain Number - Region: 470-584
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0523
Family HBL-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001179   Gene: ENSMPUG00000001190   Transcript: ENSMPUT00000001204
Sequence length 1734
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896908.1:11534842:11641572:1 gene:ENSMPUG00000001190 transcript:ENSMPUT00000001204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKLLAKIHDGEVRSQNYQIAITITEARQLVGENIDPVVIIEVGEEKKQSTVKEGTNSPFY
NEYFVFDFIGPQLHLFDKIIKISVFHHKLIGSILIGSFKVDLGTVYNQPGHQFCDKWALL
TDPGDIRTGTKGYLKCDISVTGKGDILKTNPKTPDAEEQIEKNLLIPQGFPSERPWARFY
VRLYKAEGLPKMNSSIMANVTKAFVGDNKDLVDPFVEVSFAGQVGRTTVQKNCADPVWHE
QVVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDKGFLPTFGPAWIN
LYGSPRNHSLMDDYQELNEGFGEGVSFRGRILVEIAVEILSGGSQEYKTNSTEVEVEPFD
VPPQITPEKCEEFLLFGAFFEATMIDRKIGDKPISFEVSIGNFGNLLDGGSHHGNKKKSA
ESAEEDSLPLLHEGEGDAAHNVAFPMVSTTHPEKPLVTEGNRNYNYLPFEAKKPCVYFIS
SWGDQTFRLHWSNMLEKMVDLLEESIEEVRELIKISEKASEDKMKAVLSDFISQSSTFIS
EAEKKPKMLNQTTLDKKRLTLCWQELEAMAKEAKGIIQQQKKKLSLDEMIHEAENLVEKL
RFLVDEPQHTIPDVFIWMLSNNKKVAYARIPSKDLLYSPNREQMGKHCAKIKTHFLKLPG
KRPAGWTVQAKVDVYLWLGSTQHSSAMLDNLPEGYEAETSSKVAGPDQPPANLLYQARHV
FQLRAHMYQARGLIAADSNGLSDPFAKVTFLSHCQTTKVISQTLSPTWNQMLLFNNLVLH
GDQKELAESPPSVVVELYDSDAVGKPEYLGATVVAPVVHLADQDYEPPRLSYHPIFCGSL
SGGDLLAVFELLQVPSSGLQGLPPIDPPDVAQIYPVPANIRPVLSKYRVEVLFWGVREMK
KVQLLSVDRPQVLIECGGRGVKSCVIQSYKNNPNFSVQADAFEVELPENELLHPPLSICV
VDWRAFGRSTLVGTYTINCLKQFLCKSKEPLVLTCQVVGTQVEQGPARGTHRKRVPHGQV
ELPEEFLLQPLQLLELLDSDSKTDIRFDVIDARKPTRRSTKRRKRTIADESAENVIDWWS
KYYASVKILSSYGKAEELAFANRNNEQVAGAGPHAHREKESNPKEKRGNAGKNSGSCLGV
VREEQKQAFSSLFSLKIYDGDLESEFNNFEDWVKTFELLRGKSTEDGHGLDGDRVIGKFK
GSFCIYKSPTDSSIEDSGQLRIQQGVPPNHPVKVLIRVYIVAAFNLSPTDPDGKADPYIV
VRLGQTEIKDRDKYIPKQLNPVFGRSFEIQATFPKDSLLSILIYDHDLIGTDDLIGETRI
DLENRFYSRHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFHPGKIEIG
NQVFSGKTVFTEEDTDETVESYEHLALRVLHSWGDIPEVGCKLVPEHIETRPLYHKNKPG
MEQGRLQMWVDMFPKDMPPPGPPVDISPRQPKGYELRVTIWNTEDVILEDENIFTGQKSS
DIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVITKRENIFSLE
KMECKTPVVLVLQVWDFERLSSDDFLGSLEMNLNSFPRAAKSAKACDLTKFENASEDSKI
SIFQQKRVRGWWPFAKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTS
FSWFVSPFKCLYHLIWKNYKKYIIIGFILIILIIFLVLFIYTLPGAISNKIVGG
Download sequence
Identical sequences M3XQ29
ENSMPUP00000001179 ENSMPUP00000001179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]