SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001182 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001182
Domain Number 1 Region: 4-444
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-77
Family GDI-like N domain 0.00000000000919
Further Details:      
 
Domain Number 2 Region: 448-536
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.45e-29
Family GDI-like 0.00000789
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001182   Gene: ENSMPUG00000001194   Transcript: ENSMPUT00000001208
Sequence length 537
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897278.1:308787:538140:1 gene:ENSMPUG00000001194 transcript:ENSMPUT00000001208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNLPSEFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGILSWLK
EYQENSDIVNESPAWQEQILENEEAIALSRKDKTIQHVEVFCYASQDLHEDVEEAGALQK
NHASVISGNPTEAAHSACLPSEDESLCSVICEVPREQTPSSDLETALEIHDVEVTGEKEK
YYDNKTCVKSGSEEETSENVPTEEDTALQPKKNRITYSQIIREGRKFNIDLVSKLLYSRG
LLIDLLIKSNVSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLTMVEKRMLMKFLT
FCMEYEKHPDQYKAYEEITFSEYLKTQKLTPSLQYFVLHSIAMTSEKASNTIEGLKATKN
FLHCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAII
DQFGQRIISKHFLVEDSYFSENTCSHVQYRQISRSVLITDRSVLKTDSDQQISILTVPGE
EPGTFAVRVIELCPSTMTCMKGTYLVHLTCTSSKTAREDLEPVVRKLFTPYTETEIG
Download sequence
Identical sequences M3XQ32
ENSMPUP00000001182 ENSMPUP00000001182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]