SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001192 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001192
Domain Number 1 Region: 8-260
Classification Level Classification E-value
Superfamily Ras GEF 6.15e-46
Family Ras GEF 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001192   Gene: ENSMPUG00000001204   Transcript: ENSMPUT00000001218
Sequence length 289
Comment pep:novel scaffold:MusPutFur1.0:GL896940.1:4619722:4625549:-1 gene:ENSMPUG00000001204 transcript:ENSMPUT00000001218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APEASCHPMNQLKEEMPDLLDFPPKLVAEQLTYMDSKLFKKVLCHQCLGSIWSRKNKPGN
EHLAPTVWTTISQFNGAVSCVITTSLVNPSMTAQDKAMVVEHWISLAKACQILGIYSSLH
AILSALQSISFHLLRRTWKNGQPDIKDSESKWMEGILLSRNVSLALQEPSNKFATLVRHL
QKAWKRCQRRTQGVVPYLGTFLTDLDYMEVGEPEHCGGGTRVLRDTMLLQVTPENYTLEP
QHPLRAWFPSVEWLSDDESWGTCVFLRLKTVLWKAAVPPGPSLLVRSMV
Download sequence
Identical sequences M3XQ42
ENSMPUP00000001192 ENSMPUP00000001192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]