SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001194 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001194
Domain Number 1 Region: 2-152,185-203
Classification Level Classification E-value
Superfamily Ras GEF 4.32e-41
Family Ras GEF 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001194   Gene: ENSMPUG00000001204   Transcript: ENSMPUT00000001220
Sequence length 210
Comment pep:novel scaffold:MusPutFur1.0:GL896940.1:4621924:4625498:-1 gene:ENSMPUG00000001204 transcript:ENSMPUT00000001220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLLDFPPKLVAEQLTYMDSKLFKKVLCHQCLGSIWSRKNKPGNEHLAPTVWTTISQFNGA
VSCVITTSLVNPSMTAQDKAMVVEHWISLAKACQILGIYSSLHAILSALQSISFHLLRRT
WKNGQKDFIYLFDRLNSIFSHGHNHDDSHRILSPQETMGGRWSSHFSRGEGPCGTRIQGL
IPTLPSMTQGVVPYLGTFLTDLVLPQTLSV
Download sequence
Identical sequences M3XQ44
ENSMPUP00000001194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]