SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001200 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001200
Domain Number 1 Region: 1513-1843
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 4.45e-91
Family Rap/Ran-GAP 0.00016
Further Details:      
 
Domain Number 2 Region: 916-1296
Classification Level Classification E-value
Superfamily ARM repeat 0.000000187
Family B56-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001200   Gene: ENSMPUG00000001210   Transcript: ENSMPUT00000001226
Sequence length 1859
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896940.1:4845732:5168967:1 gene:ENSMPUG00000001210 transcript:ENSMPUT00000001226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRRSHGDVRKSTQKVLDPKKDVLTRLKHLRALLDNVDASDLKQFFETNYSQIYFIFYE
NFITLENSLKLKGNNKSQREELDSILFLFEKILQFLPERIFFRWHYQSIGSTLKKLLHTG
NSVKIRCEGIRLFLLWLQALQTNCAEEQVLIFACLVPGFPAIMSSRGPCTLETLINPSPG
VADAKIYPEEITPLLPAISGEKIAEDQTCFFLQILLKYMVIQAASLEWKNKENQDTGFKF
LFTLFRKYYLPHLFPSFTKLTNIYKPVLDIPHLRPKPVYITTTRDNENIYSTKIPYMAAR
VVFIKWIVTFFLEKKYLTTTQNTKNGVDVLPKIIQTVGGGVGQERVPELDGGCPTEQDKN
HSNSSTLSDRRLSNSSLCSIEEEHRTVYEMVQRILLSTRGYVNFVNEVFRQAFLLPSCDI
AVTRKVVQVYRKWILQDKPVFMEEPDKKEAAQEDAEKLGFSETDSKETSSEGSRHKRSSS
WGRTYSFTSAVSRGCVTEEENKNVKAGAQAMLQVFLTNAANVFLLEPCPEVPMLLKEQVD
ACKAVLIIFRRMIMELTMNKKTWEQMLQILLRITEAVMQKPKDKQIKDLFAQSLAGLLFR
TLMVAWIRANLCVYISRELWDDFLGVLSSLTEWEELINEWANIMDSLTAVLARTVYGVEM
TNLPLDKLSEQKEKKQRGKGCVLDSQKGTTVGRSFSLSWRSHPDVTEPMRSRSATTSGAP
GVEKARNIVRQKATEVEECQQSENAPAAESGCLAVEQQHLTRSSSTPDVTEPLCSDSPQE
SKAIQENKGHVKKEHEGITILVRRSSSPAELDLKDDLQQTQGKCKERQKSESISSDTALG
YNNEAELSMSPWPTCEEDPELNTPTDAVTDSDARHWLQLSPTDASNLTDSSECLADDCSI
IAGGNLTGWHPDSAAVLWRRILGILGDVNNIQSPKIHAKVFGYLYELWYKLAKIRDNLAI
SLDNQSSPSPPVLIPPLRMFASWLFKATMLPNEYKEGKLQAYRLMCAMMTRRQDVLPNSD
FLVHFYLVMHLGLTSEDQDILNTIIRHCPPRFFSLGLPGFSMLVGDFITAAARVLSTDTP
ATPHSEALTILGSLVCFPNTYREIPLLQSVPEVREVITGTEDVKHYLINILLKNATEEPN
ECARCIAICSLGVWICEELAQCTNHPQLKEAVNVIGVTLKFSNKIVAQVACDVLQLLVSY
WEKLQMFETSLPRKIAEILVATIAFLLPSAEYSSVETDKKFIVSLLLCLLDWCMALPVST
LLHPVSTAALEEQHSSRAPLLDYIYRVLHCCVCGSSTYTQQSHYTLTLADLSSPDYDPFL
PLANVKNSEPVQYHSSADLGNLLTVEEERKRRSLELIPLTARMVMAHLVNHLGHFPLCGG
PAVLHSLVSENHDNAHAEAPELSSEVFRSPNLQLFVLNDSTLISYLQTPSEGPAGGSRGG
ALSDVRVIVRDISGKYSWDGKVLYGPLEGCLAPSSRNPAFLISGWQPQALGAQKDFSQIE
EGDDVLDKLLENIGHTSPECLLPSQLNLNEPSPPPRGMNRDQEKEIIEVILRQNAQEDNY
IQRCNSDSAMKITSQEQPSPVEPRGPFYFCRLLLDDLGMNSWDRRKNFHLLKKNSKLLRE
LKNLDSRQCRETHKIAVFYIAEGQEDKCSILSNERGSQAYEDFVAGLGWEVDLSTHCGFM
GGLQRNGSTGQTAPYYATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHSR
DYRRGIIPTAFGDVSIIIYPVKNHMFFIAITKKPEVPFFGPLFDGAIVSGKLLPSLICAT
CINASRAVKCLIPLYQSFYEERALYLEAIIQNHREVMTFEDFAAQVFSPSPNPSLGGTD
Download sequence
Identical sequences M3XQ50
ENSMPUP00000001200 XP_012912505.1.14098 ENSMPUP00000001200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]