SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001220 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001220
Domain Number 1 Region: 542-783
Classification Level Classification E-value
Superfamily VPS9 domain 2.22e-54
Family VPS9 domain 0.001
Further Details:      
 
Domain Number 2 Region: 98-219
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-17
Family SH2 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 800-881
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000284
Family Ras-binding domain, RBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001220   Gene: ENSMPUG00000001230   Transcript: ENSMPUT00000001246
Sequence length 905
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896940.1:5523284:5706049:-1 gene:ENSMPUG00000001230 transcript:ENSMPUT00000001246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGEMSAWTMGARSLDKRGSFFKLIDTIVSEIGELKQEMVQTDVSLKNGLEPNKAHSMV
RHKDDGYSEEKDVKTCPRDSGYDSLSNRLSILDRLLHTHPIWLQLSLSEEEAAQILQSQP
PGIFLVRKSTKMQKKVLSLRLPCEFGAPLKEFTIKESTYTFSLEGSGISFADLFRLIAFY
CISRDVLPFTLKLPYAISTAMTEARLEELAQLGLNFWSSPADNKPPNPPPPHRPLSSDGV
CPASRQLCLINGVHSIKTRTPSELECSQTNGALCFINPLFLKVHSQDLSGGLKRPCTRTP
NANGTERPRSPPPRPPPPAINSLHTSPQLSRTEAQASMPETVNHNKHGNVALLGTKPTPI
PPPRLKKQASFLEAEGSAKTLTGGRPRPGREREPEEPEQPQPRTAGRPGGAPPAEAPGDC
TRAAGPESRPPWHGGRQRLSDMSISTSSSDSLEFDRSMPLFGYEADTNSSLEDCEEESDQ
ETMAPPIKSKKKRNSSFVLPKLVKSQLRKMSGVFSSFMTPEKRMVRRIAELSRDKCTYFG
CLVQDYVSFLQENKECHVSSTDMLQTIRQFMTQVKNYLAQSSELDPPIESLIPEDQIDVV
LEKAMHKCILKPLKGHVEAMLRDFHMADGSWKQLKENLQLVRQRNPQELGVFAPTPDIVD
VEKIKVKFMTMQKMYSPEKKVMLLLRVCKLIYTVMENNSGRMYGADDFLPVLTYVIAQCD
MLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSETRDTLRQ
WHKRRTTNRTIPSVDDFQNYLRVAFQEVDSGCTGKTLLVRPYVTTEDVCQLCAEKFKVGD
PEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGVIFQNGEE
DLTTS
Download sequence
Identical sequences M3XQ70
ENSMPUP00000001220 XP_004754192.1.14098 XP_004754193.1.14098 XP_004754195.1.14098 XP_004754199.1.14098 ENSMPUP00000001220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]