SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001270 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001270
Domain Number 1 Region: 647-765
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.18e-30
Family PLC-like (P variant) 0.047
Further Details:      
 
Domain Number 2 Region: 325-449
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.43e-27
Family PLC-like (P variant) 0.028
Further Details:      
 
Domain Number 3 Region: 967-1096
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.56e-27
Family Synaptotagmin-like (S variant) 0.0023
Further Details:      
 
Domain Number 4 Region: 479-609
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.97e-23
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 5 Region: 798-910
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.97e-20
Family Synaptotagmin-like (S variant) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001270   Gene: ENSMPUG00000001281   Transcript: ENSMPUT00000001297
Sequence length 1101
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897076.1:650467:665997:1 gene:ENSMPUG00000001281 transcript:ENSMPUT00000001297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSPADGSSPSLVDQPSTPSDPSDQPPAAHAKPDLGSGNQPASPGAAGEAMALLSSFGR
RLLVLVPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEERLTAKTL
YMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNTHLQTFT
FTRVELGEKPLRIVGVKVHPGRSKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLH
GVLRVILEPLMGDLPIVGAVSMFFIRRPTLDINWTGMTNLLDIPGLSSLSDTMIMDSIAA
FLVLPNRLLVPLVPDLHDVAQLRSPLPRGIIRIHLLAARGLGSKDKYVKGLIEGKSDPYA
LVRVGTQAFCSQVIDEDLNPQWGETYEVMVHEVPGQEIEVEVFDKDPDKDDFLGRMKLDV
GKVLQAGVLDDWFPLQGGQGQVHLKLEWLSLLPNAEKLEQVLQWNRGVSSRPEPPSAAIL
VVYLDRAQDLPLKKANKEPNPMVQLSIQDMTQESKAVYCTNSPVWEEAFRFFLQDPRSQE
LDVQVKDDSRALTLGALTLPLARLLTAPELTLDQWFQLSSSGSNSRLYMKLVMRILYLDS
SEVHFPTVPGTPGAWDLDESPQTGSSVDVPPRPSHTTPESHFGMENVLRIHVLEAQDLIA
KDRFLGGLVKGKSDPYVKLKLAGRSFRSRVVREDLNPRWNEVFEVIVTSIPGQELDIEVF
DKDLDKDDFLGRCKVSLTAVLNTGFLDEWLALEDVPSGRLHLRLERLTPQPTAAELEEVL
QVNSLIQTQKSAELAAALLSVYLERADELPLRKGTKPPSAYATLTVGDTSHKTKTIAQTS
APVWDETASFLIKRPHTESLELQVRGEGTGTLGSFSLPLSELLGADQLCLDRWFTLNNGQ
GQVLLRAQLGILVSQHSGVEAHSHSHSSSSLSEEPELWGGLPHSTTSAPELRQRLTHGDS
ALEAPAGPLGQVRLTVWYYSEERKLVSIVHSCRALRQNGREAPDPYVSLLLLPDKNRGTK
RKTSQKKRTLNPEFNERLEWELPLDEVLRRKLDVSVKSNSSFMSRERELLGKVQLDLAEI
DLSQGAAQWYDLMDDKEKGGS
Download sequence
Identical sequences M3XQC0
XP_004773147.1.14098 ENSMPUP00000001270 ENSMPUP00000001270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]