SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001301 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001301
Domain Number 1 Region: 3-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.92e-76
Family IMD domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001301   Gene: ENSMPUG00000001312   Transcript: ENSMPUT00000001328
Sequence length 687
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896908.1:11974228:12129981:-1 gene:ENSMPUG00000001312 transcript:ENSMPUT00000001328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQK
VADMATNTRGGTREIGSALTRMCMRHRSIETKLRQFSSALIDCLINPLQEQMEEWKKVAN
QLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETE
KQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSS
EQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSHYR
YRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPDAPNQLSNGFSHCSLPNFAH
CHTIGPGMFPSSQIPSWKDWAKPGPYDQPLVNTLQRRKEKREPDPNGGGPTAVGGAPAAA
EEAQRPRSMTVSAANRPGEEMEACEELALALSRGLQLDTQRSSRDSLQCSSGYSTQTTTP
CCSEDTIPSQVSDYDYFSVSGDQEADQQEFDKSSTIPRNSDISQSYRRMFQAKRPASTAG
LPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPIPIKTPVIPVKTPTVPDLPGVLPA
PPDGPEERGPKPSIPEEHRQAIPESEAEDQERDPSSATASPGRIPESDAADLSPRDTPQG
EDMLNAIRRGVKLKKTTTNDRSAPRFS
Download sequence
Identical sequences M3XQF1
ENSMPUP00000001301 ENSMPUP00000001301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]