SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001306 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001306
Domain Number 1 Region: 10-228
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-64
Family DBL homology domain (DH-domain) 0.00000000278
Further Details:      
 
Domain Number 2 Region: 228-347
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-25
Family Pleckstrin-homology domain (PH domain) 0.000000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001306   Gene: ENSMPUG00000001317   Transcript: ENSMPUT00000001333
Sequence length 347
Comment pep:novel scaffold:MusPutFur1.0:GL896955.1:9218366:9238813:1 gene:ENSMPUG00000001317 transcript:ENSMPUT00000001333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRLCFPGCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESEL
LTEKEGAMVFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILTAQLPHMQPYIRF
CSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNI
LENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFN
SVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQIIKPLGSSGSDKVFSPKSHLL
YKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINER
Download sequence
Identical sequences M3XQF6
ENSMPUP00000001306 ENSMPUP00000001306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]