SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001307 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001307
Domain Number 1 Region: 123-297,401-510
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.92e-41
Family FAD-linked reductases, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001307   Gene: ENSMPUG00000001318   Transcript: ENSMPUT00000001334
Sequence length 588
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896908.1:12325088:12349658:1 gene:ENSMPUG00000001318 transcript:ENSMPUT00000001334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFLGIATFTYFYKKCGDFVSFANKELLLCVLVFLSLGLVLSYRYRYRSGAALGRQQSG
SQFALFSDILSALPLIGFFWAKSPPGSENKEQLGSRRHKKGSNISETTLIGAAASSVSFQ
NDPEVIIVGSGVVGSALAAMLSRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLQDLDLE
DAVEGIDAQVVDGYIIHDQESKSEVQIPYPLSENSQVRSGRAFHHGRFIMGLRKAAMAEP
NTKFIEGIVLQLLEEDDAVIGVQYRDRETGDIKELHAPLTVVADGLFSKFRKNLISNKVS
VSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSNETRVLVDIRGEMPRNLREYMA
EKIYPQLPDYNGNCMKIQFIFYTDHLKEPFLEATQNSRLRSMPASFLPSSPVNKRGVLLL
GDAYNMRHPLTGGGMTVVFKDLKLWRKLLKGIPDLYDDAAVFQAKKSFYWARKTSHSFVV
NILAQALYELFSAPDDSLHQLRKACFLYFKLGGECVAGPVGLLSVLSPNPLILIGHFFAV
AIYATYFCFKSEPWITKPRAILSSGAVLYKACSVIFPLIYSEIKYLVH
Download sequence
Identical sequences M3XQF7
ENSMPUP00000001307 ENSMPUP00000001307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]