SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001316 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001316
Domain Number 1 Region: 366-449
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.47e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001316   Gene: ENSMPUG00000001327   Transcript: ENSMPUT00000001343
Sequence length 453
Comment pep:known scaffold:MusPutFur1.0:GL896908.1:14591048:14596901:1 gene:ENSMPUG00000001327 transcript:ENSMPUT00000001343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDFLRIVENPQAAAMPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPS
EDIWKKFELLPTPPLSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELL
GGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSSSPSPAR
GPGGCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSS
AESSPRASPEPLALHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGS
HSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPR
SSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSV
QTEEQKLISEKDLLRKRREQLKHKLEQLRNSGA
Download sequence
Identical sequences G9KC04
ENSMPUP00000001316 ENSMPUP00000001316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]