SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001320 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001320
Domain Number 1 Region: 106-444
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 9.04e-70
Family Arginine methyltransferase 0.00000538
Further Details:      
 
Domain Number 2 Region: 26-85
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-16
Family SH3-domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001320   Gene: ENSMPUG00000001331   Transcript: ENSMPUT00000001347
Sequence length 457
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897242.1:21:33443:-1 gene:ENSMPUG00000001331 transcript:ENSMPUT00000001347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSDDCLQGELQEGEGHVECGDREQLQEGVQPEEFVAIADYSATDQTQLSFLRGEKILI
LRQTTADWWWGERAGCCGYIPANHLGKHLEDCDPEDTWQDEEYFGSYGTLKLHLEMLADQ
PRTTKYHNVILQNKESLKDKVILDVGCGTGIISLFCAHYAQPKAVYAVEASEMAQHTGQL
VMQNGFADIITVFQQKVEDVVLPEKVDVLVSEWMGTCLLERITPDLNRVFQKMEEDRLPA
HLFEFMIESILYARDAWLKEGGVIWPTTAALHLVPCSADRDYRSKVLFWDNAYEFNLSAL
KSLAIKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQIADLETMKGELHFEIRKAGAL
HGFTAWFSVRFQSLEEDEPQLVLSTGPFHPTTHWKQVLFMMDEPVSVVPGDVVTGSVVLQ
RNPVWRRHMSVALSWSVTSTQDPTSQKGGEKVFPIWR
Download sequence
Identical sequences M3XQH0
ENSMPUP00000001320 ENSMPUP00000001320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]