SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001329 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001329
Domain Number 1 Region: 79-205
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.89e-67
Family RUNT domain 0.000000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001329   Gene: ENSMPUG00000001340   Transcript: ENSMPUT00000001356
Sequence length 480
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896955.1:10025854:10274217:-1 gene:ENSMPUG00000001340 transcript:ENSMPUT00000001356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDSIFESFPSYPQCFMRECVHGMNPSRDVHDASTSRRFTPPSTALSPGKMSEALPLGA
PDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVA
LGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVF
TNPPQVATYHRAIKITVDGPREPRRPRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSP
HHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT
PISPGRASGMTTLSAELSSRLTTAPDLTAFGDPRQFPALPSISDPRMHYPGAFTYSPTPV
TSGIGIGMSAMSSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVG
GERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
Download sequence
Identical sequences M3XQH9
ENSMPUP00000001329 ENSMPUP00000001329 XP_004757596.1.14098 XP_004757597.1.14098 XP_004757600.1.14098 XP_004757601.1.14098 XP_004757602.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]