SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001334 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001334
Domain Number 1 Region: 862-1198
Classification Level Classification E-value
Superfamily NHL repeat 5.23e-24
Family NHL repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 1096-1328
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000173
Family All0351-like 0.05
Further Details:      
 
Domain Number 3 Region: 299-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.081
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001334
Domain Number - Region: 557-626
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000208
Family Carboxypeptidase regulatory domain 0.037
Further Details:      
 
Domain Number - Region: 268-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000381
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 365-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 397-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000495
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 233-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 430-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 203-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0301
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 1766-1864,1956-2016
Classification Level Classification E-value
Superfamily NHL repeat 0.0523
Family NHL repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001334   Gene: ENSMPUG00000001346   Transcript: ENSMPUT00000001362
Sequence length 2400
Comment pep:known scaffold:MusPutFur1.0:GL896983.1:994045:1273938:1 gene:ENSMPUG00000001346 transcript:ENSMPUT00000001362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACFLAAVHLFGLTWQLQPVEGQLYENGVSKGNRGTESVDTTYSPIGGKVSDKSEKKVFQ
KGRAIDTGEVDIGAQVMQTIPPGLFWRFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPP
THTQFDFVKLMDGKQLVKQDSKGSDDTQHSPRNLILTSLQETGFIEYMDQGPWYLAFYND
GKKMEQVFVLTTAIEIMDDCSTNCNGNGECISGHCHCFPGFLGPDCARDSCPVLCGGNGE
YEKGHCVCRNGWKGPECDVPEEQCIDPTCFGHGTCIMGVCICVPGYKGEICEEEDCLDPM
CSSHGICVKGECHCSTGWGGVNCETPLPICQEQCSGHGTFLLDTGVCSCDPKWTGSDCST
ELCTMECGSHGVCSRGICQCEEGWVGPTCEERSCHSHCAEHGQCKDGKCECSPGWEGDHC
TIAHYLDAVRDGCPGLCFGNGRCTLDQNGWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGD
GLTDCVDPDCCQQSNCYISPLCQGSPDPLDLIQQSQPLFSQHTSRLFYDRIKFLIGKDST
HVIPPEISFDSRRACVIRGQVVAIDGTPLVGVNVSFLHHSDYGFTISRQDGSFDLVAIGG
ISVILIFDRSPFLSEKRTLWLPWNQFIVVEKVTMQRVVSDPPSCDISNFISPNPIVLPSP
LTSFGGSCPERGTIVPELQVVQEEIPIPSSFVRLSYLSSRTPGYKTLLRILLTHSTIPVG
MIKVHLTVAVEGRLTQKWFPAAINLIYTFAWNKTDIYGQKVWGLAEALVSVGYEYETCPD
FILWEKRTVILQGFEMDASNLGGWSLNKHHILNPQSGIIHKGNGENMFISQQPPVISTIM
GNGHQRSVACTNCNGPAHNNKLFAPVALASGPDGSVYVGDFNFVRRIFPSGNSVSILELR
NRDTRHSTSPAHKYYLAMDPMSESLYLSDTNTRKVYRLKSLVEAKDLSKNFEVVAGTGDQ
CLPFDQSHCGDGGKASEASLNSPRGITVDRHGFIYFVDGTMIRRIDEKAVITTVIGSNGL
TSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLYVLDNNIVLQISENRRVRIIAGRPIH
CQVPGIDHFLVSKVAIHSTLESARAISVSHSGLLFIAETDERKVNRIQQVTTNGEISIIA
GAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSSLAVSPDGTLYVADLGNVRIRTISRNQ
AHLNDMNLYEIASPADQELYQFTVNGTHLHTLNLITRDYVYNFTYNAEGDLGAVTSSNGN
SVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKRVSAQGYNLALMTYPGNTGLLATKSN
ENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEKLTKVELDTSNRENVLMSTNLTATST
IYILKQENTQSTYRVSPDGSLRVTFASGMEISLSSEPHILAGAVNPTLGKCNISLPGEHN
ANLIEWRQRKEQNKGNISAFERRLRAHNRNLLSIDFDHITRTGKIYDDHRKFTLRILYDQ
TGRPILWSPVSRYNEVNITYSPSGLVTFIQRGTWNEKMEYDQSGKIISRTWADGKIWSYT
YLEKSVMLLLHSQRRYIFEYDQSDCLLSVTMPSMVRHSLQTMLSVGYYRNIYTPPDSSTS
FIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLSEILYDTTQVTLTYEESSGVIKTIHLM
HDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFDYSYNNFRVTSMQAVINETPLPIDLY
RYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTKIFSANGQVIEVQYEILKAIAYWMTI
QYDNMGRMVICDIRVGVDANITRYFYEYDADGQLQTVSVNDKTQWRYSYDLNGNINLLSH
GNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQRGNDIFEYNSNGLLQKAYNKASGWT
VQYYYDGLGRRVASKSSLGQHLQFFYADLANPIRVTHLYNHTSSEITSLYYDLQGHLIAM
ELSSGEEYYVACDNTGTPLAVFSSRGQVIKEILYTPYGDIYHDTYPDFQVIIGFHGGLYD
LLTKLVHLGQRDYDVVAGRWTTPNHHIWKQLNLLPKPFNLYSFENNYPVGKIQDVAKYTT
DIGSWLELFGFQLHNVLPGFPKPELENLELTYELLQLQTKTQEWDPGKTILGIQCELQKQ
LRNFISLDQLPMTPRYNDGRCLEGGKQPRFAAVPSVFGKGIKFAIKDGIVTADIIGVANE
DSRRLAAILNNAHYLENLHFTIEGRDTHYFIKLGSLEEDLVLIGNTGGRRILENGVNVTV
SQMTSVLNGRTRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRR
LQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences M3XQI4
ENSMPUP00000001334 ENSMPUP00000001334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]