SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001346 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001346
Domain Number 1 Region: 10-143
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.67e-44
Family Cofilin-like 0.000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001346   Gene: ENSMPUG00000001358   Transcript: ENSMPUT00000001374
Sequence length 155
Comment pep:novel scaffold:MusPutFur1.0:GL896940.1:7589658:7625776:-1 gene:ENSMPUG00000001358 transcript:ENSMPUT00000001374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSPNDSFGFLKASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIV
EEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELA
PLKSKMIYASSKDAIKKKFQGLVRFSMCLGHPPEA
Download sequence
Identical sequences M3XQJ6
ENSMPUP00000001346 ENSMPUP00000001346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]