SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001366 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001366
Domain Number 1 Region: 4-58
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000196
Family DBL homology domain (DH-domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001366   Gene: ENSMPUG00000001378   Transcript: ENSMPUT00000001394
Sequence length 79
Comment pep:novel scaffold:MusPutFur1.0:GL897059.1:24925:27857:-1 gene:ENSMPUG00000001378 transcript:ENSMPUT00000001394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKQELLKWTPRKHSDHTAVIEALQAMKVVYSNINEAKRQIEKLEVLEEWQSHIEGWELL
QTLEDHLRDDTLAPVTKIS
Download sequence
Identical sequences M3XQL6
ENSMPUP00000001366 ENSMPUP00000001366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]