SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001373 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001373
Domain Number 1 Region: 560-709
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-66
Family Ankyrin repeat 0.00000178
Further Details:      
 
Domain Number 2 Region: 53-290,322-347
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.53e-65
Family BAR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 438-554
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.94e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00000546
Further Details:      
 
Domain Number 4 Region: 313-430
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-20
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 5 Region: 1056-1130
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001373   Gene: ENSMPUG00000001385   Transcript: ENSMPUT00000001401
Sequence length 1132
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896908.1:16548765:16890854:-1 gene:ENSMPUG00000001385 transcript:ENSMPUT00000001401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSASRLSSFSSRDSLWNRMPDQISVSEFITETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGLRKVWQRRKCAVKNGILTISHAT
SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT
MAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDVCCDCGSSEPTWLSTNLGILTCIECSGI
HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSTKPTPSSDMTVRK
EYITAKYVDHRFSRKACSSSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTALHYCSMYSKPECLKLLLRSK
PTVGVVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEMDESDDD
LDDKPSPIKKERSPRPQSFCHSSSISPQDKLSLPGFSTPRDKQRLSYGAFTNQIFVSTST
DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
PPSPLPHGPPNKGAVPWGNDVGPSSSSKTANKFEGLSQQSSTGSAKTALGPRVLPKLPQK
VALRKTETSHHLSLDKANIPAEIFQKSSPLAELPQKPPPGDLPPKPTELAPKPQIGDLPP
KPGELPPKPQLGDLPPKPQLADLPPKPQMKDLPPKPQLGDLLAKSQTGEVSPKAQQPPDV
TQKSHPADLSPNVQSRDAIQKQASEDATDLTPTLPETPVPLPRKINTGKNKVRRVKTIYD
CQADNDDELTFMEGEVIVVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Download sequence
Identical sequences M3XQM3
ENSMPUP00000001373 XP_004743622.1.14098 ENSMPUP00000001373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]