SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001377 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001377
Domain Number 1 Region: 22-127
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-21
Family SH3-domain 0.0000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001377   Gene: ENSMPUG00000001388   Transcript: ENSMPUT00000001405
Sequence length 129
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896940.1:8318334:8322725:-1 gene:ENSMPUG00000001388 transcript:ENSMPUT00000001405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLLLFSLPGLVAICAVHGIFMDRLASKKLCADDECVYTISLARAREDYNAPDCRFINV
KKGQQIYIYSKLVQENGAGEFWAGSVYGDDREDEMGTLGYFPSSLVEEQHVYQDATKEVP
TTDIDFFCE
Download sequence
Identical sequences M3XQM7
XP_004754250.1.14098 ENSMPUP00000001377 ENSMPUP00000001377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]