SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001410 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001410
Domain Number 1 Region: 369-678
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.49e-121
Family Mammalian PLC 0.000000285
Further Details:      
 
Domain Number 2 Region: 209-368
Classification Level Classification E-value
Superfamily EF-hand 5.02e-42
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 
Domain Number 3 Region: 698-823
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-30
Family PLC-like (P variant) 0.00029
Further Details:      
 
Domain Number 4 Region: 80-193
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-29
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001410   Gene: ENSMPUG00000001422   Transcript: ENSMPUT00000001439
Sequence length 1076
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897081.1:2309830:2650091:-1 gene:ENSMPUG00000001422 transcript:ENSMPUT00000001439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPHLLQEDTTMQRWEEPALFVNVMMNKNELSGLYAFPLSECVVPISSSKSKDGTKQKRE
RKKTVSFSSMPTEKKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPS
KKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESLDLVANTAD
VANIWVTGLRYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIR
DLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFVEVFHELCTRPEIYFLLVQFSSNKEF
LDTKDLMMFLEAEQGVAHINEEISLEIISKYEPSKEGQEKGWLSIDGFTKYLMSPDCYIF
DPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDG
PDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKK
ILGDKLYTTSPNVEESYLPSPDVLKGRILIKAKKLSSNCSGVEGDVTDEDEGAEMSQRMG
KENVEQPNNVPVKRFQLCKELSELVSICKSVQFKEFQVSFQVQKYWEVCSFNEVLASKYA
NENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGW
FRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGD
VVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYI
GDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVR
KGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLM
QCMLAVSPRFLGPDNTPLVVLNLSEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKAVIEN
ADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKRPTKVSAAH
QRENSYVPGDRAPQLTKKEPPGRAAAVSLSTDGMWRDRGCTPQSTLCRVHPCDVPE
Download sequence
Identical sequences M3XQR0
ENSMPUP00000001410 ENSMPUP00000001410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]