SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001534 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001534
Domain Number 1 Region: 112-307
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.19e-74
Family T-box 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001534   Gene: ENSMPUG00000001549   Transcript: ENSMPUT00000001566
Sequence length 602
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897059.1:1254182:1359566:1 gene:ENSMPUG00000001549 transcript:ENSMPUT00000001566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERRRSAVALSSRAHAFSVEALIGSNKKRKLRDWEEKGLDLSMEALSPAGPLADSEDAA
AHGLEPHPDSEQSTGSDSEVLTERTSCSFDTHPDLGSGAAGPVPAAMSSMEEIQVELQCA
DLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSS
KWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKY
QPRVHVIRKDFSSDLSPTKPVPVGDGVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAK
GFRDSGRNRTGLEAIMETYAFWRPPVRTLTFEDFTTMQKQQGGSTGTSPTTSSTGTPSPS
ASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSG
YNRLQSGTASATQPSETFMPQRTPSLISGIPTPPSLPSNSKMEAYGGQLGSFPTSQFQYV
MQAGNAASSSSSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQS
TLLCSSPSNGAFGERQYLPTGMEHSMHMISPSPNNQQATNTCDGRQYGAVPGSSSQMSVH
MV
Download sequence
Identical sequences M3XR34 U6CVF9
XP_004771107.1.14098 ENSMPUP00000001534 ENSMPUP00000001534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]