SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001568 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001568
Domain Number 1 Region: 494-596
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-24
Family PDZ domain 0.0000282
Further Details:      
 
Domain Number 2 Region: 1199-1268
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.57e-18
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001568   Gene: ENSMPUG00000001584   Transcript: ENSMPUT00000001601
Sequence length 1312
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897028.1:5227636:5526248:-1 gene:ENSMPUG00000001584 transcript:ENSMPUT00000001601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKTESSGERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGESSQQSRGRKYG
SNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGPSSPQRRMRPKEFLEKTDGSVVKLESSV
SERISRFDTMYDGPSYSKFTETRKMFERSVHESGQNNRYSPKKEKAGGSEPQDEWGGSKS
NRGSTDSLDSLSSRTEAVSPTVSQLSAVFENTDSPSAIVPEKAENNAYSVTGHYPLNLPS
VTVTNLDTFGHLKDSNSWSPPSKHGDDAEDSQKGHTTPGPEVALKSTSLASIPSEETQQS
EEAEDSTSNQETPVGIDRDVPEEPCADTKAMPESEIPSPQNEPLEDAEANLVGSEAAMHQ
KKELAGGDFTSADASGSRCGKEVPEDSVHFESSHVYMHSDYNVYRVRSRYNSDWGETGTE
QDEQEESDENSYYQPDMEYSEIVGLPEEDDIPANRKIKFSSAPIKVFSTYSNEDYDRRND
EVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVT
EGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGREKPGQVSEVA
QLISQTLEQERRQRELLEQHYAQYDADDDETGEYATDEEEDEVGPVLPGGDMAIEVFELP
ENEDMFSPSDLDTSKLSHKFKELQIKHAVTEAEIQKLKTKLQAAENEKVRWELEKTQLQQ
NIEENKERMLKLESYWIEAQTLCHTVNEHLKETQSQYQALEKKYNKAKKLIKDFQQKELD
FLKRQEAERKKIEDLEKAHLVEVQGLQVRIRDLEAEVFRLLKQNGTQVNNNNNIFERRTS
LGDVSKGDTMENLDVKQTSCQDGLSQDLNEAVPETERLDSKALKTRAQLSVKNRRQRPSR
TRLYDSVSSTDGEDSLERKPSNSFYNHTHISKSLLPKGLRTSPESDSGTPSLTPVAGSVP
FSSDHIAEFPEGPLSPEKEPSSLIWGDTSLSSPSKSDHDMEESPYHHQATTKKTPQEKDG
AKGPKSLRASSSLVMQGGKIKRKFVDLGAPLRRSSNKGKKWKEKEKEATRFSPGSRIFRS
RLEHWKPKPSPAPQASTRSPCIPFSWFNESRKGSYSFRDLPSPTRPLQPSPETLISDKKG
SKNFTFNDDFSPSSTSSADLSGLGAEPKTAGLSQSLALSSDEILDDGQSPKHSQCQSRAV
HEWSVQQVSHWLMSLNLEQYVSEFSAQNITGEQLLQLDGNKLKALGMTSSQDRAVVKKKL
KEMKVSLEKARKAQEKMEKQREKLRRKEQEQMQRKSKKTEKMTAVSEGAGEQ
Download sequence
Identical sequences M3XR68
ENSMPUP00000001568 ENSMPUP00000001568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]