SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001620 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001620
Domain Number 1 Region: 22-118
Classification Level Classification E-value
Superfamily Immunoglobulin 5.59e-23
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001620   Gene: ENSMPUG00000001637   Transcript: ENSMPUT00000001654
Sequence length 133
Comment pep:novel scaffold:MusPutFur1.0:AEYP01112886.1:901:1476:1 gene:ENSMPUG00000001637 transcript:ENSMPUT00000001654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSNLLKVVMASVWLGSSIAQKITQAQPAMLVQEKGTVILECTYNTNEPRYSLLWYKQP
SSGAMVFLIRQDSYNLQNATEGRYSLNFQKTRNFIQLVISASQLEDSAVYFCALREATVR
GMMEGGIPKPQGS
Download sequence
Identical sequences M3XRC0
ENSMPUP00000001620 ENSMPUP00000001620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]